DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and GCN20

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_116664.1 Gene:GCN20 / 850561 SGDID:S000001905 Length:752 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:69/290 - (23%)
Similarity:124/290 - (42%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 KQQESDTTIMYLGRAPSFQ--------NFEFG--DVGSVELMRLRHVSTSHRDSERKILKNISMR 523
            |.||:.:.|..|.:.|..:        :|:|.  |..|..:::|:.||..: |....:||::::.
Yeast   491 KSQEAQSRIKKLEKLPVLEPPEQDKTIDFKFPECDKLSPPIIQLQDVSFGY-DENNLLLKDVNLD 554

  Fly   524 IYRGEVFVILGHIGSGKLTLLRILAGLKFPLRGNVYIMGNPFEPNGEARRLVDFRFDEHGLNKHL 588
            :.......::|..|.||.|||:|:.....||:|  ::..||        ||....|.:|.::...
Yeast   555 VQMDSRIALVGANGCGKTTLLKIMMEQLRPLKG--FVSRNP--------RLRIGYFTQHHVDSMD 609

  Fly   589 TVEQTIDYHVRLKLSPSESDRYEIERRKWLAILDQHVESRGV-------RIGKLSSGSMKLVALC 646
            .....:|:  ..|..|.::|.   |.|:       |:.|.|:       ::..||.|....||..
Yeast   610 LTTSAVDW--MSKSFPGKTDE---EYRR-------HLGSFGITGTLGLQKMQLLSGGQKSRVAFA 662

  Fly   647 CCLAGDTPIIILEEPTTQL--TGREAQIFWSIVHAEKE-NRAFIIATYNVGEAEHVADRIGILSM 708
            .....:..|::|:||:..|  ||.:|     :|.|.|. |...::.::::...:.|...|.:...
Yeast   663 ALCLNNPHILVLDEPSNHLDTTGLDA-----LVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQ 722

  Fly   709 GVLEA-SGTPFFLRSKFSSSVDLVIIKKPH 737
            |.::. .||.:..|.....|.|...:.|.|
Yeast   723 GTVKRFEGTIYDYRDYILQSADAAGVVKKH 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 53/228 (23%)
P-loop_NTPase 500..721 CDD:304359 54/231 (23%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
GCN20NP_116664.1 PLN03073 <190..742 CDD:215558 65/278 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.