DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and ABCE2

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_193656.2 Gene:ABCE2 / 827661 AraportID:AT4G19210 Length:605 Species:Arabidopsis thaliana


Alignment Length:394 Identity:93/394 - (23%)
Similarity:151/394 - (38%) Gaps:112/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 SALIYFLILLAIQWRMPGTFLSRRIVNNRPRKQQESDTTIMYLGRAPSFQNFEFGDVGSVELMRL 502
            |.|.|....:...:..||.:    .|...|...:|. ..|...|..|: :|..|.|    |.:..
plant   277 SVLDYLSDFICCLYGKPGAY----GVVTLPFSVREG-INIFLAGFVPT-ENLRFRD----ESLTF 331

  Fly   503 RHVSTSHRDSER-------------KILKNISMRIYRGE-----VFVILGHIGSGKLTLLRILAG 549
            :...|....:|.             |...|..:|:..||     :.|:||..|:||.|.:|:|||
plant   332 KVAETPQESAEEIQSYARYKYPTMTKTQGNFRLRVSEGEFTDSQIIVMLGENGTGKTTFIRMLAG 396

  Fly   550 LKFPLRGNVYIMGNPFEPNGEARRLVDF-----------RFDEHGLNKHLTVEQTIDYHVRLKLS 603
            |.           .|.:..|..|.:.:|           :|...  .:||..::..|.::..:..
plant   397 LL-----------KPDDTEGPDREIPEFNVSYKPQKISPKFQNS--VRHLLHQKIRDSYMHPQFM 448

  Fly   604 PSESDRYEIERRKWLAILDQHVESRGVRIGKLSSGSMKLVALCCCLAGDTPIIILEEPTTQLTGR 668
            .......:||:     ::||.|.:       ||.|.::.|||..||.....|.:::||:..|.. 
plant   449 SDVMKPLQIEQ-----LMDQEVVN-------LSGGELQRVALTLCLGKPADIYLIDEPSAYLDS- 500

  Fly   669 EAQIFWS------IVHAEKE----NRAFIIATYNVGEAEHVADRIGILSMGVLEASGTPFFLRSK 723
            |.:|..|      |:||:|.    ...||:|||       :|||       |:...|.|      
plant   501 EQRIVASKVIKRFILHAKKTAFVVEHDFIMATY-------LADR-------VIVYEGQP------ 545

  Fly   724 FSSSVDLVIIKKPHVPDQPITDYINQFMQNIEPENEIGDSLTYRL-PVIYRPRLQKLLIHLEIDR 787
               |:|..    .:.| |.:...:|.|:.::        ::|:|. |..:|||:.||....:.::
plant   546 ---SIDCT----ANCP-QSLLSGMNLFLSHL--------NITFRRDPTNFRPRINKLESTKDREQ 594

  Fly   788 KMLG 791
            |..|
plant   595 KSAG 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500 3/9 (33%)
EcfA2 499..717 CDD:224047 61/256 (24%)
P-loop_NTPase 500..721 CDD:304359 62/259 (24%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
ABCE2NP_193656.2 Rli1 4..603 CDD:224166 93/394 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.