DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and abca4a

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_001002206.1 Gene:abca4a / 798993 ZFINID:ZDB-GENE-050517-3 Length:280 Species:Danio rerio


Alignment Length:107 Identity:29/107 - (27%)
Similarity:43/107 - (40%) Gaps:29/107 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1040 IPLTVSVFVIPLVEEEIYDVRFLQHMAGLGLK-------------VF---WGINLFWDWFTFFVY 1088
            :|||.|| |..|:..:|...:|...:..|.||             :|   ||:        :.|.
Zfish   171 VPLTESV-VQQLINSQIRPEQFAYGVPDLHLKDIACSQTLLERFLIFPNRWGL--------YAVR 226

  Fly  1089 SVIIVVIMSLMGIGGFGFYENAIMVVLLTTFGLAALPLTYLV 1130
            :.:.|:....:.|....||.|.....|   |.|.:| ||:||
Zfish   227 NAMCVLTPQRLQIIEDKFYANLDFFKL---FRLVSL-LTHLV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047
P-loop_NTPase 500..721 CDD:304359
ABC2_membrane_3 <972..1254 CDD:289468 29/107 (27%)
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
abca4aNP_001002206.1 rim_protein 1..>260 CDD:130324 25/101 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.