DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and tomm22

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_001039252.1 Gene:tomm22 / 734118 XenbaseID:XB-GENE-951173 Length:126 Species:Xenopus tropicalis


Alignment Length:32 Identity:11/32 - (34%)
Similarity:21/32 - (65%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 TSFRLQQQMIPDVTQTFKYQVVSQKQLTKQRM 842
            |||.:  .::|.|.:|.|.|:..|:||.::::
 Frog    78 TSFMI--LVLPVVFETEKLQMEQQQQLQQRQI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047
P-loop_NTPase 500..721 CDD:304359
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
tomm22NP_001039252.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.