DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and abcg4a

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:XP_687685.2 Gene:abcg4a / 564842 ZFINID:ZDB-GENE-050517-39 Length:641 Species:Danio rerio


Alignment Length:218 Identity:57/218 - (26%)
Similarity:100/218 - (45%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 RKILKNISMRIYRGEVFVILGHIGSGKLTLLRILAGLK-FPLRGNVYIMGNPFEPNGEARRLVDF 577
            :.:||.:|.:....|:..|:|..|:||.||:.||||.: ..::|.:.:       ||..|.|..|
Zfish    76 KALLKCLSGKFCSRELIGIMGPSGAGKSTLMNILAGYRETGMKGQILV-------NGRPRDLRTF 133

  Fly   578 R------FDEHGLNKHLTVEQTIDYHVRLKLSPSESDRYEIERRKWLAI-LDQHVESRGVRIGKL 635
            |      ..:..|..|||..:.:.....|||:.:...:.|:......|: |.:..::|.:   .|
Zfish   134 RKMSCYIMQDDMLLPHLTTREAMMVSANLKLNENMEVKKELVNEILTALGLQECAQTRTI---SL 195

  Fly   636 SSGSMKLVALCCCLAGDTPIIILEEPTTQLTGREAQIFWSIVHAEKENRAFIIATYNVGEAE--H 698
            |.|..|.:|:...|..:.|::..:|||:.|.........|::.:..:....||.|.:...|:  .
Zfish   196 SGGQCKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGGRTIICTIHQPSAKLFE 260

  Fly   699 VADRIGILSMGVLEASGT-PFFL 720
            :.|::.|||.|.....|| |:.:
Zfish   261 MFDKLYILSQGQCIYKGTVPYLI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 56/213 (26%)
P-loop_NTPase 500..721 CDD:304359 57/218 (26%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
abcg4aXP_687685.2 3a01204 38..641 CDD:273361 57/218 (26%)
ABCG_EPDR 53..277 CDD:213180 54/210 (26%)
ABC2_membrane 372..574 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.