DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and pak1ip1

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_001017054.2 Gene:pak1ip1 / 549808 XenbaseID:XB-GENE-492186 Length:365 Species:Xenopus tropicalis


Alignment Length:276 Identity:52/276 - (18%)
Similarity:98/276 - (35%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1351 LVGQRGFAFGEIYVRGLDFKYDL---------------------ESIHTY-MGYSPQHRGLLNE- 1392
            |.|.|....||.::...||.:..                     |:|..| |....:|..||:. 
 Frog    16 LFGYRVHREGEQWLSSADFTHHAHTASLSVVAVNNRFVATGSKDETIQIYDMKKKVEHGALLHHN 80

  Fly  1393 --LTPREHIRLLCMIRGVPEAKIGEKMHDLCLMLNMTGWMHRKCSLLTAEKRHKLKI-ALALVAY 1454
              :|..:......::.|..:..|       |:      |..:|.......|.||.:: :|::...
 Frog    81 GTITCLQFYGNTHLLSGAEDGLI-------CV------WNTKKWECQQTFKAHKGQVLSLSIHPS 132

  Fly  1455 NKILVLDEPTCGMPATTRREIWNI-------LRYIRYCGKTIIFATNDELECKILADFIILFQDS 1512
            .|:.:    :.|...|.|  .||:       ::.|:.....:.::.:.:....::.|.:.::|..
 Frog   133 GKLAL----SVGTDKTLR--TWNLVEGRSAFIKNIKKNAHIVQWSPSGDKYVVVIHDKVDVYQLE 191

  Fly  1513 EMLAIGSLQYLRYKYSHGFYLEVRLIRDG-ATLAESEENLR-KDVENLAKFVNFLHNRSELVGRL 1575
            ....||::...:...|      |:.|.|. ..:|..||.:| .|..:......|..:.:    |:
 Frog   192 TAAVIGTINNPKRISS------VQFITDALIAVAGDEEVIRLYDTASQKCVCEFKAHEN----RV 246

  Fly  1576 NNWFKFYVPVGHIVYS 1591
            .|...|.:...|||.|
 Frog   247 KNLHVFELEETHIVVS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047
P-loop_NTPase 500..721 CDD:304359
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047 35/202 (17%)
P-loop_NTPase 1324..1524 CDD:304359 35/205 (17%)
pak1ip1NP_001017054.2 WD40 <35..294 CDD:225201 45/257 (18%)
WD40 39..272 CDD:238121 45/253 (18%)
WD40 repeat 43..78 CDD:293791 6/34 (18%)
WD40 repeat 84..119 CDD:293791 6/47 (13%)
WD40 repeat 124..160 CDD:293791 7/41 (17%)
WD40 repeat 168..200 CDD:293791 4/31 (13%)
WD40 repeat 205..240 CDD:293791 9/40 (23%)
WD40 repeat 248..288 CDD:293791 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.