DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and Abca16

DIOPT Version :10

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:XP_006507746.1 Gene:Abca16 / 233810 MGIID:2388711 Length:1679 Species:Mus musculus


Alignment Length:118 Identity:27/118 - (22%)
Similarity:44/118 - (37%) Gaps:43/118 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 GKELYKSKYDIVVKKNLEMEETITTLEKNLKTLQMEMKEKFGVEDNLQRMRNTIDDLEAEISKKN 377
            ||: |.||.|.:.::.:        .|||||.:                   ::.:|||.:....
Mouse    34 GKQ-YNSKVDEISRRLI--------WEKNLKKI-------------------SVHNLEASLGAHT 70

  Fly   378 LEIEDFLDEKHRMDREIKELKEIVHQMEVP-------STTTTP----RIMDSL 419
            .|    |...|..|...:|:.:.:..:.||       .|..||    |:.||:
Mouse    71 YE----LAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:463674 14/65 (22%)
rim_protein <514..1537 CDD:130324
Abca16XP_006507746.1 rim_protein <196..1665 CDD:130324
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.