DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and AgaP_AGAP012005

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:XP_320530.4 Gene:AgaP_AGAP012005 / 1280669 VectorBaseID:AGAP012005 Length:735 Species:Anopheles gambiae


Alignment Length:239 Identity:49/239 - (20%)
Similarity:94/239 - (39%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 TFLSRRIVNNRPRKQQESDTTIMYLGRAPSFQNFEFGDVGSVELMRLRHVSTSHRDSERKILKNI 520
            |..:.::::.:..|.:...|......|..:| :..|||                    :.:|:|.
Mosquito   181 TATASQVISKKDNKMESKGTNRSMDIRIDNF-DVSFGD--------------------KTLLQNA 224

  Fly   521 SMRIYRGEVFVILGHIGSGKLTLLRILAGLKFPLRGNVYIMGNPFEPNGEARRLVDFRFD----- 580
            .:.:..|..:..:|..|.||.|||::::|.:..:..::.::....|..|:....:|...:     
Mosquito   225 DLLLASGRRYGFVGRNGLGKTTLLKMISGKQLQIPSHISVLHVEQEVVGDDTTALDSVLEVDTVR 289

  Fly   581 ------EHGLNKHLTVEQTIDYHVRLKLSPSESDRYEIERRKWLA----ILD-----QHVESRGV 630
                  |..||..:....| |.::..:||...:....||..|..|    ||:     :.:::|..
Mosquito   290 TELLQRERDLNAQIAAGST-DANLGNELSEVYNQLQTIEADKAPARASIILNGLGFTKEMQARAT 353

  Fly   631 RIGKLSSGSMKLVALCCCLAGDTPIIILEEPTTQLTGREAQIFW 674
            |  ..|.|....:||...|.....:::|:|||..|..:  .|.|
Mosquito   354 R--TFSGGWRMRLALARALFSKPELLLLDEPTNMLDIK--AIIW 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 41/196 (21%)
P-loop_NTPase 500..721 CDD:304359 41/195 (21%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
AgaP_AGAP012005XP_320530.4 PLN03073 8..727 CDD:215558 49/239 (21%)
ABCF_EF-3 206..427 CDD:213188 46/214 (21%)
ABC_tran_Xtn 425..508 CDD:289608
ABCF_EF-3 520..711 CDD:213188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.