DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and AgaP_AGAP002638

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:XP_312290.4 Gene:AgaP_AGAP002638 / 1273324 VectorBaseID:AGAP002638 Length:776 Species:Anopheles gambiae


Alignment Length:316 Identity:82/316 - (25%)
Similarity:126/316 - (39%) Gaps:56/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1255 IELHRREKKFHTSRDLRKMRTATYPFDDGDVADVKQKIAEADNTKAKQSVFLVDQVEARVPAAGK 1319
            ::|..|.|||.:......:|.        ..|...::..:...||...:|.| |.:...||    
Mosquito    25 LDLAARRKKFMSQPSTVAIRR--------QQAVCVRRAHKIYGTKKNPNVIL-DGLNMTVP---- 76

  Fly  1320 RIHTVSFALNKYMSMGIFGPRNSGKSHLMRQLVGQRGFAFGEIYV-------RGLDFKYDLESIH 1377
                      |....|:.|....||:.|:..:||:|....|||:|       ||....      .
Mosquito    77 ----------KGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVP------G 125

  Fly  1378 TYMGYSPQHRGLLNELTPREHIRLLCMIRGVPEAKIGEKMHDLCLMLNMTGWMHRKCSLLTAEKR 1442
            ..:||.||...|..|.|.||.:.....|.|:...::.||...||.:|.:.. ..|....|:..::
Mosquito   126 PRVGYMPQEVALYGEFTIRETLIYFGWIYGMTTDQVDEKTDFLCKLLQLPN-ASRFVKNLSGGQQ 189

  Fly  1443 HKLKIALALVAYNKILVLDEPTCGMPATTRREIWNILRYIRYCGKTIIFATNDELECKILADFII 1507
            .::.:|.||:...::|:|||||.|:....|:.||:.|..|...|.|.:..|...:|....|..|.
Mosquito   190 RRMSLAAALLNEPELLILDEPTVGVDPVLRQSIWDHLVEITKSGNTTVIVTTHYIEETRQAHVIG 254

  Fly  1508 LFQDSEMLAIGSLQYLRYKYSHGFYLEVRLIRDGATLAESEEN--LRKDV-ENLAK 1560
            |.:..:.||..|...|..:|.                |||.|:  |:..| :|:.|
Mosquito   255 LMRGGKFLAEESPADLLAQYQ----------------AESLEDVFLKLSVLQNMGK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047
P-loop_NTPase 500..721 CDD:304359
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047 61/220 (28%)
P-loop_NTPase 1324..1524 CDD:304359 58/206 (28%)
AgaP_AGAP002638XP_312290.4 PQQ_ABC_ATP 48..286 CDD:274822 73/275 (27%)
ABC_DR_subfamily_A 56..261 CDD:213197 62/226 (27%)
ABC2_membrane_3 394..769 CDD:289468
ABC2_membrane 569..737 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.