DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and ABCG1

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:XP_024307909.1 Gene:ABCG1 / 9619 HGNCID:73 Length:786 Species:Homo sapiens


Alignment Length:767 Identity:160/767 - (20%)
Similarity:273/767 - (35%) Gaps:234/767 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SIMSLIIL--LSFIYPC-TYITKYITAEKEKQLKEVMKIMGLSNWLHW----------TAWFVKS 321
            |:.:.|:|  |..:.|. |::::|..|.:...          ..|::|          .||.:::
Human     7 SVCTAILLARLWCLVPTHTFLSEYPEAAEYPH----------PGWVYWLQMAVAPGHLRAWVMRN 61

  Fly   322 FIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAV 386
            .:...|.:.....|.    .|:.||||....||....:.:..::|           ::..::..|
Human    62 NVTTNIPSAFSGTLT----HEEKAVLTVFTGTATAVHVQVAALAS-----------AKLESSVFV 111

  Fly   387 TGLIWFIAYIPYSFTINSYDDLSLSSK-------LGWSLI----SNTAMGFGIKLILGFEGTGEG 440
            |..:        |..|.:..|.:|..|       .|.|::    ||..:          :.:...
Human   112 TDCV--------SCKIENVCDSALQGKRVPMSGLQGSSIVIMPPSNRPL----------KASAAS 158

  Fly   441 LQWSNFFTPVSVD-DTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRP--WNFPFTREFW 502
            ..||     |.|. ....||.|.|.               .:|:..:.|..|.  |.||      
Human   159 CTWS-----VQVQGGPHHLGVVAIS---------------GKVLSAAHGAGRAYGWGFP------ 197

  Fly   503 CGEREYTGVEDIPNGHVEQRDPKAFETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITV 567
                               .||                    ...|.|.::||:|......|:..
Human   198 -------------------GDP--------------------MEEGYKTLLKGISGKFNSGELVA 223

  Fly   568 LLGHNGAGKTTTISML-----TGMFPPTSGTAIING--SDIR--TNIEGARMSLGICPQHNVLFD 623
            ::|.:||||:|.:::|     |||    .|..:|||  .|:|  ..:....|...:...|..:.:
Human   224 IMGPSGAGKSTLMNILAGYRETGM----KGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQE 284

  Fly   624 EMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTK 688
            .|.||.|::...:.:|.|     :.|.:.|..:.|...||..:..||||.:::|::...|..:..
Human   285 AMMVSAHLKLQEKDEGRR-----EMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPP 344

  Fly   689 VVLCDEPSSGMDPSARRQLWDLLQ-QEKVGRTLLLTTHFMDEADV--LGDRIAIMCDGELKCQGT 750
            |:..|||:||:|.::..|:..|:: ..:.||:::.|.| ...|.:  |.|::.::..|:      
Human   345 VMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIH-QPSAKLFELFDQLYVLSQGQ------ 402

  Fly   751 SFFLKKQYGSGYRLICVKRDDCETNEVTALLNKYIPGLKPECDIGAEL-SYQLP-----DSASAK 809
                           ||.|     .:|..|    :|.|:   |:|... :|..|     :.||.:
Human   403 ---------------CVYR-----GKVCNL----VPYLR---DLGLNCPTYHNPADFVMEVASGE 440

  Fly   810 FEEMFGQL-----EEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIK---DQHEIMNGGSGF 866
            :.:...:|     |...|..|....|........::.:...|...|..:|   .....|.|...|
Human   441 YGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSF 505

  Fly   867 RGEDDNE----------SVQSDGIFSENR-------RLLQGLQLL--SNQWKAMLLKK-FLYTWR 911
            ......:          |:..|.:.:..|       .||.||..|  .|:.|.:|... ||:.  
Human   506 SASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFF-- 568

  Fly   912 NKLLLLIQNIMPVFFVVVTILIIKTQ-GTF-QELKPITISLTQYPLAVTVLD 961
            :.|.|:...:||      |:|....: |.| :|......||..|.||.|:.|
Human   569 SMLFLMFAALMP------TVLTFPLEMGVFLREHLNYWYSLKAYYLAKTMAD 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500 33/187 (18%)
ABC2_membrane_3 <269..475 CDD:289468 41/229 (18%)
CcmA 538..843 CDD:224054 76/327 (23%)
ABC_subfamily_A 538..755 CDD:213230 58/228 (25%)
ABC2_membrane_3 913..1316 CDD:289468 16/51 (31%)
ABC_subfamily_A 1369..1587 CDD:213230
drrA 1376..1702 CDD:130256
ABCG1XP_024307909.1 3a01204 202..786 CDD:273361 111/464 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.