DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and Abcg1

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:NP_445954.2 Gene:Abcg1 / 85264 RGDID:620294 Length:666 Species:Rattus norvegicus


Alignment Length:629 Identity:126/629 - (20%)
Similarity:244/629 - (38%) Gaps:174/629 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 DIPNGHVEQRD-----PKAFETEPEGKHIGLQMRHLK---------KRFGNKMVVKGLSMNMFED 563
            |:.|||:::.|     .:.|.:.|....:.::.:.|.         ::.|.|.::||:|......
  Rat    47 DLLNGHLKKVDNNFTEAQRFSSLPRRAAVNIEFKDLSYSVPEGPWWRKKGYKTLLKGISGKFNSG 111

  Fly   564 EITVLLGHNGAGKTTTISML-----TGMFPPTSGTAIING--SDIR--TNIEGARMSLGICPQHN 619
            |:..::|.:||||:|.:::|     |||    .|..:|||  .|:|  ..:....|...:...|.
  Rat   112 ELVAIMGPSGAGKSTLMNILAGYRETGM----KGAVLINGMPRDLRCFRKVSCYIMQDDMLLPHL 172

  Fly   620 VLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALC 684
            .:.:.|.||.|::...:.:|.|     :.|.:.|..:.|...||..:..||||.:::|::...|.
  Rat   173 TVQEAMMVSAHLKLQEKDEGRR-----EMVKEILTALGLLPCANTRTGSLSGGQRKRLAIALELV 232

  Fly   685 GDTKVVLCDEPSSGMDPSARRQLWDLLQ-QEKVGRTLLLTTHFMDEADV--LGDRIAIMCDGELK 746
            .:..|:..|||:||:|.::..|:..|:: ..:.||:::.|.| ...|.:  |.|::.::..|:  
  Rat   233 NNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIVCTIH-QPSAKLFELFDQLYVLSQGQ-- 294

  Fly   747 CQGTSFFLKKQYGSGYRLICVKRDDCETNEVTALLNKYIPGLKPECDIGAEL-SYQLPDSASAKF 810
                               ||.|         ..::..:|.|:   |:|... :|..|  |....
  Rat   295 -------------------CVYR---------GKVSNLVPYLR---DLGLNCPTYHNP--ADFVM 326

  Fly   811 EEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIMNGGSG--------FR 867
            |...|:..:|:..|                  |.|.::...:...:.|:  ||.|        ..
  Rat   327 EVASGEYGDQNSRL------------------VRAVREGMCDSDYKREL--GGDGDVNPFLWHRP 371

  Fly   868 GEDDNESVQSDGIFSEN---------RR---------LLQGLQLLSNQWKAMLLKKFLYTWRNKL 914
            .|:|:.|::....||.:         :|         :|..|::.|:....:|:........|:.
  Rat   372 AEEDSASMEGCHSFSASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIGIGLLIGLLYLGIGNEA 436

  Fly   915 LLLIQNIMPVFFVVVTILIIKTQGTFQELKPITISLTQYPLAVTVLDRSNVQNGTGYEIANKYED 979
            ..::.|...:||.::.::       |..|.|..::   :||.::|..|.::         |.:..
  Rat   437 KKVLSNSGFLFFSMLFLM-------FAALMPTVLT---FPLEMSVFLREHL---------NYWYS 482

  Fly   980 LARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQ--------- 1035
            |...|                    |.||:   .:..:.:...:....|..|:.:|         
  Rat   483 LKAYY--------------------LAKTM---ADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVL 524

  Fly  1036 --ALHTAPLTVNMVHNAIADKLFGSSVKIQVTNAPLPYTTSTLL 1077
              ||.|   ..::|..::...:..:|..:||.....|.|...:|
  Rat   525 FAALGT---MTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054 73/326 (22%)
ABC_subfamily_A 538..755 CDD:213230 59/237 (25%)
ABC2_membrane_3 913..1316 CDD:289468 29/176 (16%)
ABC_subfamily_A 1369..1587 CDD:213230
drrA 1376..1702 CDD:130256
Abcg1NP_445954.2 3a01204 60..666 CDD:273361 121/616 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.