DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and abca4a

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:NP_001002206.1 Gene:abca4a / 798993 ZFINID:ZDB-GENE-050517-3 Length:280 Species:Danio rerio


Alignment Length:241 Identity:51/241 - (21%)
Similarity:85/241 - (35%) Gaps:85/241 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLWKNWTLQWNHKWQMVIELVLPAIFSLLLVLVRTLVDTEQKGVRYYNEQNLTDLNLLQHSLHR 76
            ||||||||::...|.::.:|::.|.:..:.||.:|       |....|.          ||..| 
Zfish     9 LLLWKNWTVRKRQKTRLFMEIMWPVVLFIGLVWLR-------KANPLYR----------QHECH- 55

  Fly    77 SSYLGKLIALIAPNRRRKNGGFSKF-EFILC-------------YSP------VNPVL------- 114
                       .||:...:.|...: :.|:|             .||      .|.:|       
Zfish    56 -----------FPNKAMPSSGVLPWIQGIVCNANNPCFQHTTRGESPGLVSNYNNSILARFWSDA 109

  Fly   115 KKLVEEAWQSLGKNKICESENATQLELDTVSKN----AFAGVQFDD-------AWANLTENDPL- 167
            ::|:.|..:.|...::.:...|....:||:..|    |..|::.:|       ..|.|..:.|| 
Zfish   110 QELLFEDTEFLQLGRLWQELMAMSSFMDTLRTNPEAIAGRGIKVEDILKDDETLTAYLLRDVPLT 174

  Fly   168 -------------PNDFHFALRFPAELRTATIAIANTWL-TMRLFP 199
                         |..|.:.:   .:|....||.:.|.| ...:||
Zfish   175 ESVVQQLINSQIRPEQFAYGV---PDLHLKDIACSQTLLERFLIFP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054
ABC_subfamily_A 538..755 CDD:213230
ABC2_membrane_3 913..1316 CDD:289468
ABC_subfamily_A 1369..1587 CDD:213230
drrA 1376..1702 CDD:130256
abca4aNP_001002206.1 rim_protein 1..>260 CDD:130324 51/241 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582261
Domainoid 1 1.000 168 1.000 Domainoid score I3783
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53524
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.