DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and CG33970

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster


Alignment Length:316 Identity:93/316 - (29%)
Similarity:158/316 - (50%) Gaps:37/316 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1336 PPPPP----TEGQLDDDVANERERILQMSSNELATKN---LVLDRVTKYYGQFMAVNQV----SL 1389
            ||..|    |....|.|:| .|.|:.....:.|||:.   :.:.|..|.||.....|.|    ::
  Fly     9 PPTAPAATATTANSDLDLA-ARRRLFISQPSTLATRRQQAVCVRRAHKMYGSSKNPNVVLDGLNM 72

  Fly  1390 CVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSI-YKMIGYCPQFDALL 1453
            .|.:...:||||.:|.||||....:.|..|::||..:|.|....|..:.: ...|||.||..||.
  Fly    73 TVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPRIGYMPQEIALY 137

  Fly  1454 DDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFG------FMKHIDKQTHAYSGGNKRKLSTAI 1512
            .:.|.||.|..|.::..:.:..|...:|.|.|...      |:|::       |||.:|::|.|:
  Fly   138 GEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKFVKNL-------SGGQQRRVSLAV 195

  Fly  1513 AVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSG-KSIVLTSHSMEECEALCTRLAIMVNGE 1576
            |::..|.::.|||||.|:||..|:.:|:.:..|..:| .::::|:|.::|| |....:.::..|:
  Fly   196 ALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGK 259

  Fly  1577 FKCIGSTQHLKNKFS----KGLILKIKVRRNLEALRQARLSGGYARNPDEQ-TVPA 1627
            .....|..:|:.:::    :.:.||:.|.:|:...|::.:    |:...|| ||||
  Fly   260 MLAEESPDYLRQQYNADSLEDVFLKLSVLQNMGKRRRSSI----AQEIVEQVTVPA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054
ABC_subfamily_A 538..755 CDD:213230
ABC2_membrane_3 913..1316 CDD:289468
ABC_subfamily_A 1369..1587 CDD:213230 68/229 (30%)
drrA 1376..1702 CDD:130256 80/269 (30%)
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 68/229 (30%)
CcmA 54..321 CDD:224054 80/270 (30%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46598
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.