DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and Abcg2

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:NP_852046.1 Gene:Abcg2 / 312382 RGDID:631345 Length:657 Species:Rattus norvegicus


Alignment Length:324 Identity:76/324 - (23%)
Similarity:126/324 - (38%) Gaps:59/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 LLGVNGAGKTTTFKMMTG--DERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREV 1461
            :||..|.||::...::..  |.|..||...:.|....:|...   ..||..|.|.::..||.||.
  Rat    77 ILGPTGGGKSSLLDVLAARKDPRGLSGDVLINGAPQPANFKC---SSGYVVQDDVVMGTLTVREN 138

  Fly  1462 LRIFCMLRGVQESRIRQLSE---DLAKSFGFMKHIDKQ-----THAYSGGNKRKLSTAIAVIGSP 1518
            |:....||..:..:..:.:|   .:.|..|..|..|.:     |...|||.:::.|..:.:|..|
  Rat   139 LQFSAALRLPKAMKTHEKNERINTIIKELGLDKVADSKVGTQFTRGISGGERKRTSIGMELITDP 203

  Fly  1519 SVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSME-ECEALCTRLAIMVNGEFKCIGS 1582
            |:::|||||||:|.:....:..::.|:...|::|:.:.|... ....|...|.::.:|:....|.
  Rat   204 SILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGKLMFHGP 268

  Fly  1583 TQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNP--------------DEQTVPAQMSQRD 1633
            .|.....|:                     |.||...|              |...|.....::|
  Rat   269 AQKALEYFA---------------------SAGYHCEPYNNPADFFLDVINGDSSAVMLNRGEQD 312

  Fly  1634 IDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEE 1697
            .:|.|    ||.|:...:...:.:..|||.      |.|:|..::..|||.|.......:...|
  Rat   313 HEANK----TEEPSKREKPIIENLAEFYIN------STIYGETKAELDQLPVAQKKKGSSAFRE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054
ABC_subfamily_A 538..755 CDD:213230
ABC2_membrane_3 913..1316 CDD:289468
ABC_subfamily_A 1369..1587 CDD:213230 52/198 (26%)
drrA 1376..1702 CDD:130256 76/324 (23%)
Abcg2NP_852046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
3a01204 46..651 CDD:273361 76/324 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.