DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA and si:cabz01083442.1

DIOPT Version :9

Sequence 1:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster
Sequence 2:XP_005172448.2 Gene:si:cabz01083442.1 / 101883419 ZFINID:ZDB-GENE-161017-133 Length:144 Species:Danio rerio


Alignment Length:151 Identity:59/151 - (39%)
Similarity:91/151 - (60%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 MEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQ 1623
            ||||||||||:||||||:|:|:||.||||::|..|..|.::|..::.                  
Zfish     1 MEECEALCTRMAIMVNGQFQCLGSIQHLKSRFGDGYTLIVRVCADVS------------------ 47

  Fly  1624 TVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDY 1688
                     |:||::.||:..:|.|:|:|::...|.:.||......:.||..:.:::..|.||||
Zfish    48 ---------DLDALETFVKETFPGSVLKEKHHNTLQYQIPPADGALTHIFSQLSTHQHTLRVEDY 103

  Fly  1689 SVSQTTLEEIFLEFAKYQRED 1709
            |||||||:::|:.||:.||::
Zfish   104 SVSQTTLDQVFVSFARQQRDE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054
ABC_subfamily_A 538..755 CDD:213230
ABC2_membrane_3 913..1316 CDD:289468
ABC_subfamily_A 1369..1587 CDD:213230 22/27 (81%)
drrA 1376..1702 CDD:130256 55/142 (39%)
si:cabz01083442.1XP_005172448.2 P-loop_NTPase <1..29 CDD:304359 22/27 (81%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.