DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and rbsA

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_418205.1 Gene:rbsA / 948264 ECOCYCID:EG10814 Length:501 Species:Escherichia coli


Alignment Length:279 Identity:64/279 - (22%)
Similarity:118/279 - (42%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 ASVQEDPYHER------GDSFTHQGQAIGVNSTKIYEVEPSHRRFKLKIKKLCKRFATNDRPALN 559
            ||:.||...|.      .|.:.|..:|.|              ..:||:..||       .|.:|
E. coli   226 ASLTEDSLIEMMVGRKLEDQYPHLDKAPG--------------DIRLKVDNLC-------GPGVN 269

  Fly   560 LFSWNVYENEVTVLMGHNGCGKSTLLKILAGLVEPSRGTVMISSHNIQT---------------- 608
            ..|:.:.:.|:..:.|..|.|::.|:|:|.|.:..:.|.|.:..|.:.|                
E. coli   270 DVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQDGLANGIVYISE 334

  Fly   609 ERKAASMELGIAFGHDMLLTGFTVIDYLRFICRVKG-LHNNIEIDGQSNYFLNVLQIGGLKT--- 669
            :||...:.||::...:|.||.      ||:..|..| |.:..|....|::    :::..:||   
E. coli   335 DRKRDGLVLGMSVKENMSLTA------LRYFSRAGGSLKHADEQQAVSDF----IRLFNVKTPSM 389

  Fly   670 -KRIRTLTDRDLCLVSICCAFVGNSPIILIDDVHSDLDKRTQSLVWNLINEEKSK-RTIILVSNS 732
             :.|..|:..:...|:|....:....::::|:....:|...:..::.|||:.|:. .:|||||:.
E. coli   390 EQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSE 454

  Fly   733 PALAENIADRMAIMSNGEL 751
            ......::||:.:|..|.|
E. coli   455 MPEVLGMSDRIIVMHEGHL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 55/233 (24%)
ABC_subfamily_A 541..761 CDD:213230 55/233 (24%)
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
rbsANP_418205.1 PRK10762 1..501 CDD:236755 64/279 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X215
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.