DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and cysA

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_416917.1 Gene:cysA / 946889 ECOCYCID:EG10183 Length:365 Species:Escherichia coli


Alignment Length:218 Identity:56/218 - (25%)
Similarity:97/218 - (44%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 LKIKKLCKRFATNDRPALNLFSWNVYENEVTVLMGHNGCGKSTLLKILAGLVEPSRGTVMISSHN 605
            ::|..:.|.|....  .||..|.::...::..|:|.:|.||:|||:|:|||...:.|.:..  |.
E. coli     3 IEIANIKKSFGRTQ--VLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRF--HG 63

  Fly   606 IQTER-KAASMELGIAFGHDMLLTGFTVIDYLRFICRV---KGLHNNIEIDGQSNYFLNVLQIGG 666
            ....| .|...::|..|.|..|....||.|.:.|...|   :...|...|..:....|.::|:..
E. coli    64 TDVSRLHARDRKVGFVFQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKAKVTKLLEMVQLAH 128

  Fly   667 LKTKRIRTLTDRDLCLVSICCAFVGNSPIILIDDVHSDLDKRTQSLV--WNLINEEKSKRTIILV 729
            |..:....|:......|::..|......|:|:|:....||.:.:..:  |.....|:.|.|.:.|
E. coli   129 LADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFV 193

  Fly   730 SNSPALAENIADRMAIMSNGELK 752
            ::....|..:|||:.:||.|.::
E. coli   194 THDQEEATEVADRVVVMSQGNIE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 56/218 (26%)
ABC_subfamily_A 541..761 CDD:213230 56/218 (26%)
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
cysANP_416917.1 PRK10851 1..352 CDD:182778 56/218 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14986
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.