DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and araG

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_416413.1 Gene:araG / 946408 ECOCYCID:EG10058 Length:504 Species:Escherichia coli


Alignment Length:215 Identity:61/215 - (28%)
Similarity:96/215 - (44%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 ALNLFSWNVYENEVTVLMGHNGCGKSTLLKILAGLVEPSRGTVMISSHNIQTERKAASMELGIAF 621
            ||...|::.|..:|..|||.||.|||||||||:|...|:.|:|:|:...:......|::..|:|.
E. coli    22 ALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGSVVINGQEMSFSDTTAALNAGVAI 86

  Fly   622 GHD--MLLTGFTVID--YLRFICRVKGLHNNIEIDGQSNYFLNVLQIGGLKTKRIRTLTDRDLCL 682
            .:.  .|:...||.:  ||..:....|:.|...::.::          ||:.|.:....|.|..|
E. coli    87 IYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYEA----------GLQLKHLGMDIDPDTPL 141

  Fly   683 ----------VSICCAFVGNSPIILIDDVHSDLDKRTQSLVWNLINE-EKSKRTIILVSNSPALA 736
                      |.|..|...|:.||..|:..|.|..|....::.:|.| .|..|.|:.||:.....
E. coli   142 KYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIDNLFRVIRELRKEGRVILYVSHRMEEI 206

  Fly   737 ENIADRMAIMSNGELKCTGT 756
            ..::|.:.:..:|....|.|
E. coli   207 FALSDAITVFKDGRYVKTFT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 61/215 (28%)
ABC_subfamily_A 541..761 CDD:213230 61/215 (28%)
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
araGNP_416413.1 araG 4..504 CDD:183077 61/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X215
SwiftOrtho 1 1.000 - -
22.000

Return to query results.
Submit another query.