DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and potG

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_415376.4 Gene:potG / 945476 ECOCYCID:EG11630 Length:377 Species:Escherichia coli


Alignment Length:411 Identity:94/411 - (22%)
Similarity:172/411 - (41%) Gaps:78/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 LKIKKLCKRFATNDRPALNLFSWNVYENEVTVLMGHNGCGKSTLLKILAGLVEPSRGTVMISSHN 605
            |:|:.|.|.:  :.:.|::..|..:|:.|:..|:|.:||||||||::|||..:||.|.:|:...:
E. coli    20 LEIRNLTKSY--DGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVD 82

  Fly   606 IQTERKAASMELGIAFGHDMLLTGFTVIDYLRFICRVKGLHNN----IEIDGQSNYFLNVLQIGG 666
            : ::.......:.:.|....|....||...:.|     ||..:    .||..:.|..|.::.:..
E. coli    83 L-SQVPPYLRPINMMFQSYALFPHMTVEQNIAF-----GLKQDKLPKAEIASRVNEMLGLVHMQE 141

  Fly   667 LKTKRIRTLTDRDLCLVSICCAFVGNSPIILIDDVHSDLDK----RTQSLVWNLINEEKSKRTII 727
            ...::...|:......|::..:......::|:|:....|||    |.|..|.:::  |:...|.:
E. coli   142 FAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDIL--ERVGVTCV 204

  Fly   728 LVSNSPALAENIADRMAIMSNGELKCTGTKPFLKNMYGHGYRLTCVKGKNYKRDELFGMMNSYMP 792
            :|::....|..:|.|:|||:.|:....| :|  :.:|.|       ....|.. |..|.:|.:  
E. coli   205 MVTHDQEEAMTMAGRIAIMNRGKFVQIG-EP--EEIYEH-------PTTRYSA-EFIGSVNVF-- 256

  Fly   793 NMSIERDIGYKVTFVLENKFED----QFPMLIDDLEENMQQLGV----VSFRIRDTSMEEIFLRF 849
                        ..||:.:.||    ..|.|:..|:.:.....|    |...:|.   |:|.|  
E. coli   257 ------------EGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRP---EKIML-- 304

  Fly   850 GCEDNDQSGAFQSHENAQVLLEEYYSTLAEANEKGRRTGWKLFFLHGRAVIYKRWIAAHRH---- 910
             ||:...:|.  :....:|:...|...|:..:.:          |....:|..:...||||    
E. coli   305 -CEEPPANGC--NFAVGEVIHIAYLGDLSVYHVR----------LKSGQMISAQLQNAHRHRKGL 356

  Fly   911 --W---IVLIFEVLAMALVAV 926
              |   :.|.:||.:..::.|
E. coli   357 PTWGDEVRLCWEVDSCVVLTV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 76/322 (24%)
ABC_subfamily_A 541..761 CDD:213230 58/227 (26%)
ABC2_membrane_3 911..>1189 CDD:289468 5/19 (26%)
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
potGNP_415376.4 potG 1..377 CDD:183226 93/409 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14986
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
22.000

Return to query results.
Submit another query.