DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and ybhR

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_415313.1 Gene:ybhR / 945403 ECOCYCID:G6409 Length:368 Species:Escherichia coli


Alignment Length:284 Identity:57/284 - (20%)
Similarity:96/284 - (33%) Gaps:79/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 IQPMLNYTILLPSELRMLDGDFRMANWMTLYNDDPNTFVLTRLNQPY--EGGFVGYVREGFIRLQ 232
            |.|:|...||.|     ......:.|......|:.|......|.|.:  ...|.      .:.|.
E. coli    27 ILPVLIQVILFP-----FAATLEVTNATIAIYDEDNGEHSVELTQRFARASAFT------HVLLL 80

  Fly   233 KSVSESFLVLTSHKSLPTIQIRRFP------------------ITGREQDPLMGNLNYGMPFIII 279
            ||..|....:.:.|:|..:   |||                  :.||..:......||       
E. coli    81 KSPQEIRPTIDTQKALLLV---RFPADFSRKLDTFQTAPLQLILDGRNSNSAQIAANY------- 135

  Fly   280 IGFLFPAQLFVWQVVSEKQSQVRQFLINMNIGNLIHFVSWYLKGLIYE--MISSLI--------- 333
                      :.|:|...|.::.:.....|...|: ..:||...|.|:  ::.|||         
E. coli   136 ----------LQQIVKNYQQELLEGKPKPNNSELV-VRNWYNPNLDYKWFVVPSLIAMITTIGVM 189

  Fly   334 IAALLKIRWDQDHGVLTQ------TPWYILI------LVLFCYNCAAVAFAIMVAAF---FRNAL 383
            |...|.:..:::.|.|.|      |.|.|.|      |::..:. |.:..||.:.|:   |..:|
E. coli   190 IVTSLSVAREREQGTLDQLLVSPLTTWQIFIGKAVPALIVATFQ-ATIVLAIGIWAYQIPFAGSL 253

  Fly   384 NAVRVLTILWIMSYVPTFILSNNL 407
            .......:::.:|.|...:|.::|
E. coli   254 ALFYFTMVIYGLSLVGFGLLISSL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468 34/171 (20%)
CcmA 541..848 CDD:224054
ABC_subfamily_A 541..761 CDD:213230
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
ybhRNP_415313.1 ABC2_membrane_3 25..351 CDD:403790 57/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.