DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and tomm22

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_001039252.1 Gene:tomm22 / 734118 XenbaseID:XB-GENE-951173 Length:126 Species:Xenopus tropicalis


Alignment Length:120 Identity:26/120 - (21%)
Similarity:40/120 - (33%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1572 MIRPMDTETENYKSGYQLEVRFKRKVNPNVSMSRATWNLINHFPMSPNKKFSAFMEI-------- 1628
            |..|.|...|.......:|...:.......::|...|.|...||.|......|.|::        
 Frog     1 MSSPSDLPLETVARSPSIEEEDEDDEELEETLSERLWGLTEMFPESLRTAAGASMDLSICAAKKF 65

  Fly  1629 -KFPDAVLTIERDDSMVFVLPLGTTTFSEIFLTLRKDAFEMNIEDYFITRNMLVG 1682
             .|....|.|.....|:.|||:       :|.|   :..:|..:.....|.:|:|
 Frog    66 YSFSRTALWIGTTSFMILVLPV-------VFET---EKLQMEQQQQLQQRQILLG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054
ABC_subfamily_A 541..761 CDD:213230
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230 2/4 (50%)
PRK14255 1371..1586 CDD:172743 4/13 (31%)
tomm22NP_001039252.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.