DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and CG11147

DIOPT Version :10

Sequence 1:NP_608444.2 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster


Alignment Length:178 Identity:53/178 - (29%)
Similarity:84/178 - (47%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1355 EERSKYAAVGIGIVSKYRRNRVLRDLDFTLAKSECLSITGANNSGKTTLLKVVVNETKMNAGQLW 1419
            |.|:.|...|    ||.....||..|:..:.:.....:.||:..||||||..:|.:.::|.|::.
  Fly     5 EVRNGYKYYG----SKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVV 65

  Fly  1420 I-------HDYSVNTHRVQCYRMVGYCPQKDSLPSEFTPRELLYIHAMLQGHRHRIGRELSEALL 1477
            :       ....|...|      ||:.||:.:|..|.|.:|.::....:.|......||..:.|.
  Fly    66 VLGAKPGEPGSGVPGSR------VGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLK 124

  Fly  1478 RLVGLTPCWNRSVRMCTTGQIRRLYFAYAVLGSPDLICVDGVPAGLDP 1525
            .|:.|.|. .:.::.|:.||.|||.||.|::..|:|:.:|....||||
  Fly   125 ELLQLPPA-RQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_608444.2 rim_protein <223..1689 CDD:130324 53/178 (30%)
ABC_subfamily_A 541..761 CDD:213230
CG11147NP_608954.1 CcmA 4..245 CDD:440746 53/178 (30%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.