DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and AgaP_AGAP002060

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:XP_320987.5 Gene:AgaP_AGAP002060 / 1281053 VectorBaseID:AGAP002060 Length:736 Species:Anopheles gambiae


Alignment Length:216 Identity:60/216 - (27%)
Similarity:100/216 - (46%) Gaps:29/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 IGIVSKYR---------RNRVLRDLDFTLAKSECLSITGANNSGKTTLLKVVVNETKMNAGQLWI 1420
            :.::|.|:         :..||..|:.::.:.....:.||:..||||||..:|....:|.|::.:
Mosquito     4 VEVISGYKYYGKANDPNKKIVLNHLNMSVTRGSIYGLLGASGCGKTTLLSCIVGRKFLNDGEINV 68

  Fly  1421 HDYSVNT--HRVQCYRMVGYCPQKDSLPSEFTPRELLYIHAMLQGHRHRIGRELSEALLRLVGLT 1483
            ...:..|  ..|...| :||.||..:|..|||.:|.:|....:.|......||..:.|..|:.| 
Mosquito    69 LGGTPGTAGSGVPGPR-IGYMPQDIALVEEFTIKETIYYFGRIYGMSKEKIRERYKLLKHLLEL- 131

  Fly  1484 PCWNRSVRMCTTGQIRRLYFAYAVLGSPDLICVDGVPAGLDP---------------TGKRIILM 1533
            |..:|.|..|:.||.||:.||.|::..|:|:.:|....||||               |.|..:::
Mosquito   132 PGDDRYVGNCSGGQQRRVSFAAAMVHEPELLILDEPTVGLDPLLREKIWQYLVETTSTSKMAVII 196

  Fly  1534 MTSTM-QAMGSSFLYTMLTGL 1553
            .|..: :|..:.|:..|..|:
Mosquito   197 TTHYIEEAKQAGFIGLMRNGI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054
ABC_subfamily_A 541..761 CDD:213230
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230 59/211 (28%)
PRK14255 1371..1586 CDD:172743 59/210 (28%)
AgaP_AGAP002060XP_320987.5 EcfA2 1..230 CDD:224047 60/216 (28%)
P-loop_NTPase 11..224 CDD:304359 58/209 (28%)
ABC2_membrane_3 349..712 CDD:289468
ABC2_membrane 530..689 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.