DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1494 and si:cabz01083442.1

DIOPT Version :9

Sequence 1:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster
Sequence 2:XP_005172448.2 Gene:si:cabz01083442.1 / 101883419 ZFINID:ZDB-GENE-161017-133 Length:144 Species:Danio rerio


Alignment Length:154 Identity:40/154 - (25%)
Similarity:64/154 - (41%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 ENIADRMAIMSNGELKCTGTKPFLKNMYGHGYRL---TCVKGKNYKRDELFGMMNSYMPNMSIER 798
            |.:..|||||.||:.:|.|:...||:.:|.||.|   .|....:....|.|              
Zfish     5 EALCTRMAIMVNGQFQCLGSIQHLKSRFGDGYTLIVRVCADVSDLDALETF-------------- 55

  Fly   799 DIGYKVTF---VLENKFED----QFP-------MLIDDLEENMQQLGVVSFRIRDTSMEEIFLRF 849
               .|.||   ||:.|..:    |.|       .:...|..:...|.|..:.:..|:::::|:.|
Zfish    56 ---VKETFPGSVLKEKHHNTLQYQIPPADGALTHIFSQLSTHQHTLRVEDYSVSQTTLDQVFVSF 117

  Fly   850 GCEDND-QSGAFQSHENAQVLLEE 872
            ..:..| :.|||   :|:..|.:|
Zfish   118 ARQQRDEEDGAF---DNSVDLSDE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 32/127 (25%)
ABC_subfamily_A 541..761 CDD:213230 10/23 (43%)
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
si:cabz01083442.1XP_005172448.2 P-loop_NTPase <1..29 CDD:304359 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.