DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1722 and H27M09.5

DIOPT Version :9

Sequence 1:NP_608443.1 Gene:CG1722 / 33101 FlyBaseID:FBgn0031168 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_491959.1 Gene:H27M09.5 / 186791 WormBaseID:WBGene00019248 Length:341 Species:Caenorhabditis elegans


Alignment Length:85 Identity:27/85 - (31%)
Similarity:43/85 - (50%) Gaps:15/85 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SPIKAATKPLSTKKLQSKVKSVGKTKPKMQQKSVKQPLKKPMRRSPLMRAALQPTILGLAKEKPV 72
            ||....:..:|||||.|.:|. .||..|...||.:.|||.|.:||..:|              |.
 Worm   269 SPGDKKSAKISTKKLISTIKP-PKTLSKKSAKSTRNPLKSPSKRSNSVR--------------PE 318

  Fly    73 KKSRVTFKKSHRRPLDAMQS 92
            ||:::..||:.::.:::.:|
 Worm   319 KKNKIISKKASKKNVESRKS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1722NP_608443.1 SNARE <76..103 CDD:304603 3/17 (18%)
H27M09.5NP_491959.1 PTZ00108 <124..321 CDD:240271 23/66 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.