DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment XIAP and Det

DIOPT Version :10

Sequence 1:NP_001158.2 Gene:XIAP / 331 HGNCID:592 Length:497 Species:Homo sapiens
Sequence 2:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster


Alignment Length:84 Identity:32/84 - (38%)
Similarity:45/84 - (53%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   163 EEARLKSFQNW--PDYAHLTPRELASAGLYYTGI---GDQVQCFCCGGKLKNWEPCDRAWSEHRR 222
            |:.|::|:::|  |:.|..:..::|.||.|:||.   .|...||.||..|..|||.|..|.||.:
  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92

Human   223 HFPNCFFVL----GRNLNI 237
            |.|.|.|..    .|||.:
  Fly    93 HAPQCEFAKLSCPERNLTV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XIAPNP_001158.2 BIR 1 26..93
BIR 28..95 CDD:237989
Interaction with caspase-7 141..149
BIR 162..232 CDD:197595 29/77 (38%)
BIR 2 163..230 28/71 (39%)
Required for interaction with SEPTIN4 isoform ARTS. /evidence=ECO:0000269|PubMed:21695558 262..277
BIR 265..331 CDD:197595
BIR 3 265..330
Required for interaction with DIABLO. /evidence=ECO:0000269|PubMed:21695558 329..350
UBA_BIRC4_8 370..419 CDD:270578
RING-HC_BIRC4_8 434..497 CDD:438374
Required for ubiquitination and subsequent degradation of BCL2 during apoptosis. /evidence=ECO:0000269|PubMed:29020630 450..497
DetNP_650608.1 BIR 31..101 CDD:459891 28/69 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.