DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32521 and CG15140

DIOPT Version :9

Sequence 1:NP_001259757.1 Gene:CG32521 / 33098 FlyBaseID:FBgn0052521 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001097171.2 Gene:CG15140 / 5740546 FlyBaseID:FBgn0032631 Length:335 Species:Drosophila melanogaster


Alignment Length:401 Identity:122/401 - (30%)
Similarity:151/401 - (37%) Gaps:119/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSCS-YNQRDGKDCGNYPTCKRRSGG 69
            |.::.:|.:...:|..:|||||.|.||.|.|.::|:|:.|.|| .|:.:...||.||||      
  Fly     4 LFSICLLIATVVNVHGFSKYGRDCRDILCAPGQKCIISRDPCSGSNKLENTQCGKYPTC------ 62

  Fly    70 GSSASNSSPNLAAPSANPSEVSHNAYAPNAPSAPSAPLPEAD----ASGGAGYG-------GAAG 123
                                |.||.|:..:.........:|:    ..||:|.|       |..|
  Fly    63 --------------------VMHNHYSSTSGETLERGKRQANQQGYGMGGSGMGRPNGMNNGGNG 107

  Fly   124 GGGSGG-YGGGFSAGGHSLYPSLPNSNGGGGGAAPYNPYGSG-GGNGGYG-GYNPYNGGYQPPSS 185
            |.|.|| ||.|.  ||.       |.||.||      .||:| ||..|.| |.|...|       
  Fly   108 GNGMGGQYGNGM--GGQ-------NRNGMGG------QYGNGMGGQNGNGMGGNGMRG------- 150

  Fly   186 GGYQPQAPGGYQPRPGYTPPAPGYDNNGGGGAQKPKDKEGGFFSNFFSNPAVSQAVSGIIAGQIA 250
               ....|||...|.|          ||.|..|      ||...|                    
  Fly   151 ---NGMGPGGMGGRGG----------NGNGMGQ------GGMGGN-------------------- 176

  Fly   251 KQLQGGGAGGPG-GGQPAGGYQPSGGYGGGPAAGGGGSGGSNILGGLLGSVLSGGGGGNAGAGGG 314
             .:..||.||.| ||...||....|...||...|.||.||:.:.|..||   .||.|||....||
  Fly   177 -GMGSGGMGGNGMGGNGMGGNGMGGNGMGGNGMGPGGMGGNGMGGNGLG---PGGMGGNGMGPGG 237

  Fly   315 SASSFLGSLLSGGNSNRGAQQGGGGSGGLGDIFSSKNFGGLFSENPSSRSGSPSSSSD-GGAKGY 378
            ...:.:|.  .||.:.|..|.|.||..|:|    .:|..|    .|:...|.|...:. ||..|.
  Fly   238 MGGNGMGG--QGGYNGRWGQNGMGGPNGMG----GRNGMG----RPNGMGGPPGGQNGMGGPPGG 292

  Fly   379 PT-QAPGNYYG 388
            |. ..|||:.|
  Fly   293 PNGMGPGNWQG 303



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39956
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.