DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32521 and CG43894

DIOPT Version :9

Sequence 1:NP_001259757.1 Gene:CG32521 / 33098 FlyBaseID:FBgn0052521 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001034004.1 Gene:CG43894 / 39464 FlyBaseID:FBgn0264486 Length:235 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:83/236 - (35%) Gaps:60/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPLLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSC-SYNQRDGKDCGNYPTCKRRS 67
            :.|:.:.::.:....|..|.|:|..|.||.|:..::|:::...| :.||::|:.||.||.|:...
  Fly     1 MELVGIYLILATTIVVQGYRKFGLSCEDIACISGKKCIVSRVPCENPNQQEGEQCGTYPECQSDQ 65

  Fly    68 GGG-------SSASNSSPNLAAPSANPSEVSHN---------------AYAPNA----------- 99
            ...       .:.:|:..::..||.:.|...:|               .:|.:|           
  Fly    66 LASDFIIDTTQTTANTRNSIIIPSTSTSRNRNNRNSDFKLLSDFSNSDTFATHAGQRQANVLVIV 130

  Fly   100 ------PSAPSAPL-----PEADASGGAGYGGA-----AGGGGSGGYGGGFSAGGHSLYPSLPNS 148
                  |..|:..|     |....|....|...     ..|.|...|....||.|..|.|..|  
  Fly   131 QDGSQQPQQPNPWLNRGQSPPCTISPLYPYSCTYPRYPNSGAGLPSYTQQRSANGPQLVPPTP-- 193

  Fly   149 NGGGGGAAPYNPYGSGGGNGGYGGYN-PYNGGYQPPSSGGY 188
                  ...||.|.| ..:..||.|. |.:....|.|:..|
  Fly   194 ------PCYYNCYPS-VRSSSYGQYGYPLSRSANPSSTNNY 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C74B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39956
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.