DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and TIM23

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_014414.3 Gene:TIM23 / 855751 SGDID:S000005300 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:31/108 - (28%)
Similarity:49/108 - (45%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CFGGG----LFQGLKGFRNAPQGL---------KRRFAGGLAAVKSRSPTIGGNFAAWGCVFSIV 76
            |:|.|    |..|:.||....|||         |.:....|..:..|.|.:|.|.......::|:
Yeast    98 CYGTGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNII 162

  Fly    77 DCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAM-FGSAII 118
            :.::..||.|.|...||.:||:.|.:..|..|:..| :.||::
Yeast   163 NSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGYSSAMV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 31/108 (29%)
TIM23NP_014414.3 3a0801s02tim23 61..212 CDD:130056 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.