DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and timm23a

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_009305093.1 Gene:timm23a / 798429 ZFINID:ZDB-GENE-020419-17 Length:232 Species:Danio rerio


Alignment Length:105 Identity:26/105 - (24%)
Similarity:43/105 - (40%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GGAFTMG-CFG--GGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGNFAAWGCVFSIVDCS 79
            |..|..| .||  .||..||...|:.|.. |.|....|..|..:..:......:...::|:...:
Zfish   105 GACFFKGAAFGTLNGLRMGLSETRDMPWS-KPRNVQILNMVTRQGASWANTLGSVALLYSVFGVA 168

  Fly    80 LVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIG 119
            :...|..||..|::.:|.:.|.:..|..|:..:....:||
Zfish   169 IEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARGGLIG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 26/105 (25%)
timm23aXP_009305093.1 Tim17 46..215 CDD:295283 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.