DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and Timm23

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_058593.2 Gene:Timm23 / 53600 MGIID:1858317 Length:209 Species:Mus musculus


Alignment Length:118 Identity:26/118 - (22%)
Similarity:43/118 - (36%) Gaps:18/118 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FTMG--CFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTI-----------GGNFAAWGCV 72
            ||:|  |..|..|..:.|.|   .|||.  ...:|..|.|:..|           .....:...:
Mouse    78 FTIGGCCMTGAAFGAMNGLR---LGLKE--TQSMAWSKPRNVQILNMVTRQGALWANTLGSLALL 137

  Fly    73 FSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSM 125
            :|.....:...|..||..|::.:|.:.|.:.....|:..:....:.|..|.|:
Mouse   138 YSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 26/118 (22%)
Timm23NP_058593.2 3a0801s02tim23 46..191 CDD:130056 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.