DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and timm17a

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001011183.1 Gene:timm17a / 496605 XenbaseID:XB-GENE-979217 Length:167 Species:Xenopus tropicalis


Alignment Length:180 Identity:101/180 - (56%)
Similarity:128/180 - (71%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||:|||||.||.|.|.::::|:|.:||:
 Frog     1 MEEYTREPCPWRIVDDCGGAFTMGMIGGGIFQAIKGFRNSPQGLKHRFKGSLISIRTRAPQLGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||::|||:|.:|.||||||||.|||:.|.||::|||..||.|||.:||:||::|||.|
 Frog    66 FAVWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAILAARNGAVAMVGSAAMGGILLALIEGAG 130

  Fly   131 ILFTRISAEQFRNSDPQNDLGRAGAFASGSGMGSGDINSSPGFEFPVVQQ 180
            |..||.::.||.|..|..:        .||.|       .||..|...||
 Frog   131 ICITRFASSQFTNVAPIPE--------DGSQM-------PPGSPFGGYQQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 92/145 (63%)
timm17aNP_001011183.1 Tim17 1..167 CDD:382951 101/180 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3798
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3458
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm9374
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.