DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and TIMM22

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_037469.2 Gene:TIMM22 / 29928 HGNCID:17317 Length:194 Species:Homo sapiens


Alignment Length:131 Identity:40/131 - (30%)
Similarity:55/131 - (41%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLK---GF--------RNAPQGLKRRFAGGLAA 54
            |.|.:.|.|.|:....|.|.|.:|...|....|:.   ||        ..|.:.||.....|::.
Human    61 MIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSY 125

  Fly    55 VKSRSPTIGGNFAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIG 119
            .|        |||..|.:||..:|.:...|...|..||::||.|.||.:..|.|:.|  |:...|
Human   126 AK--------NFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA--GAIGCG 180

  Fly   120 G 120
            |
Human   181 G 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 40/131 (31%)
TIMM22NP_037469.2 Tim17 69..186 CDD:396842 37/123 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.