DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and tim17

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_593342.1 Gene:tim17 / 2543163 PomBaseID:SPAC3A12.16c Length:164 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:63/144 - (43%)
Similarity:95/144 - (65%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGNFA 67
            :::|:|||:.|::|.|.||:||..||.::..:||:||:|.|.||  ...:||.|:|:|.:||||.
pombe     5 DHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPGEKR--ISAIAAAKTRAPVLGGNFG 67

  Fly    68 AWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVGIL 132
            .||.:||..||::..:|:||||||:|::|...||.|:.|.|..|....||....:|::.||:||.
pombe    68 VWGGLFSTFDCAVKGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGAIGCACILAVFEGLGIA 132

  Fly   133 FTRISAEQFRNSDP 146
            ..|::||..|...|
pombe   133 LGRMNAEYNRPVAP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 63/144 (44%)
tim17NP_593342.1 Tim17 3..162 CDD:295283 63/144 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1485
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1309
OMA 1 1.010 - - QHG54844
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm47021
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.