powered by:
Protein Alignment CG1724 and timm-17B.2
DIOPT Version :9
Sequence 1: | NP_608439.2 |
Gene: | CG1724 / 33097 |
FlyBaseID: | FBgn0031164 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367715.1 |
Gene: | timm-17B.2 / 183965 |
WormBaseID: | WBGene00017069 |
Length: | 140 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 28/53 - (52%) |
Similarity: | 36/53 - (67%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 VKSRSPTIGGNFAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRN 107
|:.||...|..|||||.:||.:||.||..|||||..|||:||.:.|.:|:.|:
Worm 4 VRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRS 56
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG1724 | NP_608439.2 |
Tim17 |
1..147 |
CDD:295283 |
28/53 (53%) |
timm-17B.2 | NP_001367715.1 |
Tim17 |
<1..>56 |
CDD:413300 |
27/51 (53%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160162487 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5596 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S575 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1590221at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001103 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 7.660 |
|
Return to query results.
Submit another query.