DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and timm-17B.1

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_500627.1 Gene:timm-17B.1 / 177242 WormBaseID:WBGene00017119 Length:181 Species:Caenorhabditis elegans


Alignment Length:135 Identity:73/135 - (54%)
Similarity:96/135 - (71%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:||.||.|.||.||..||.:||...|::||.:|  ::..|.:..|:.||...|..
 Worm     1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAKG--KKLVGMMREVRMRSTLTGVQ 63

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            |||||.:||.:||.||.:||||||.|||:||.:.|.:|:.|:|...|.||||:|.|:|:||||||
 Worm    64 FAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVG 128

  Fly   131 ILFTR 135
            ::.||
 Worm   129 LVTTR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 73/135 (54%)
timm-17B.1NP_500627.1 3a0801so1tim17 1..172 CDD:130053 73/135 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162488
Domainoid 1 1.000 124 1.000 Domainoid score I3404
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I2720
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm14555
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.