DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and TIMM17A

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_006326.1 Gene:TIMM17A / 10440 HGNCID:17315 Length:171 Species:Homo sapiens


Alignment Length:172 Identity:100/172 - (58%)
Similarity:127/172 - (73%) Gaps:10/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||:|.|:..|..|.|.|:|:|:|.:||:
Human     1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||::|||:|.:|.||||||||.|||:.|.||::|||..||.|||.:||:||::|||.|
Human    66 FAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 ILFTRISAEQFRNSDPQNDLGRAGAFASG-SGMGSGDINSSP 171
            ||.||.::.||.|. ||        ||.. |.:.|..:.|||
Human   131 ILLTRFASAQFPNG-PQ--------FAEDPSQLPSTQLPSSP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 91/145 (63%)
TIMM17ANP_006326.1 3a0801so1tim17 1..171 CDD:130053 100/172 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..171 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152391
Domainoid 1 1.000 168 1.000 Domainoid score I3821
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3506
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm8479
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.