DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and timm22

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001373736.1 Gene:timm22 / 100537779 ZFINID:ZDB-GENE-101021-3 Length:201 Species:Danio rerio


Alignment Length:133 Identity:38/133 - (28%)
Similarity:52/133 - (39%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKG-----------FRNAPQGLKRRFAGGLAA 54
            |.|...|.|.|:.:..|.|.|.:|...|....|:..           ...|.:.||.....|::.
Zfish    68 MIERGMESCAFKSLIACVGGFVLGGAFGVFTAGIDANVGLDPKDPLRTPTAREVLKDMGQRGMSY 132

  Fly    55 VKSRSPTIGGNFAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIG 119
            .|        |||..|.:||..:|.:...|.|.|..|::.||.|.||.:..|.|:.|        
Zfish   133 AK--------NFAIVGAMFSCTECLIESHRGKSDWKNAVYSGCITGGAIGFRAGLKA-------- 181

  Fly   120 GVL 122
            |||
Zfish   182 GVL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 38/133 (29%)
timm22NP_001373736.1 Tim17 76..193 CDD:396842 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.