DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and Senp8

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001165542.1 Gene:Senp8 / 71599 MGIID:1918849 Length:234 Species:Mus musculus


Alignment Length:217 Identity:55/217 - (25%)
Similarity:98/217 - (45%) Gaps:18/217 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VALRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQHRRYRSELD-LHFLNPGLAARLRHMNM 151
            |.|.:||..||.|||.||...: .:|:.::.|.:.|..:.::....| :.|::|.:...::..:.
Mouse    17 VVLSYMDSLLRQSDVSLLDPPS-WLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSS 80

  Fly   152 RQLWAM-VRDRRLNEKQFILVPLSTHPRPHG---HWSLLVISRPDSKFYHYDSLDNCHSPLAASV 212
            ....|| :....|..|:.:.:.::.:.....   ||||||..:..:.|:||||....:|..|..|
Mouse    81 PAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQV 145

  Fly   213 SETLRAPL--EAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTDHVADYVARCGYATSS 275
            :|.|:|.|  :..|...|       |.:|..:|.|   ...|::::|.|:.:...:.|....:..
Mouse   146 AEKLKAFLGSKGDKLVFV-------EEKAPAQENS---YDCGMYVICNTEALCQSLFRRQPESPL 200

  Fly   276 LLIAVDQIAAMRTHLVELIQSL 297
            .|:....|...|....:||..|
Mouse   201 QLLTPTYITKKRGEWKDLIARL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 20/92 (22%)
Senp8NP_001165542.1 Peptidase_C48 39..201 CDD:304959 38/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 1 1.010 - - QHG54524
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.