DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and ulp-3

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001023477.1 Gene:ulp-3 / 3565434 WormBaseID:WBGene00006738 Length:210 Species:Caenorhabditis elegans


Alignment Length:204 Identity:49/204 - (24%)
Similarity:76/204 - (37%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYL-QHRRYRSELDLHFLNPGLAARLRH----- 148
            |.:..:.|...||.:|:......|::|:.|...:| ||....:|:.:  ..|.....:||     
 Worm     9 LSYESVVLTADDVTILEHTGCWFNDKLLTFCAEFLEQHNSAAAEIQI--FTPPQTEMIRHSTCDE 71

  Fly   149 ----------MNMRQLWAMVRDRRLNEKQFILVPLSTHPRPHGHWSLLVISRPDSKFYHYDSLDN 203
                      :|.:.|.|.:    :|:.|.:     |......|||||:..|...||.|:||...
 Worm    72 EVDMYFGCLDVNSKDLIAFI----VNDNQDV-----TRVNGGSHWSLLIFDRKIDKFRHFDSARG 127

  Fly   204 CHSPLAASVSETLRAPLEAWKFALVTGR----------CLQQERQAAGKEGSGRDPASGIHLMCM 258
            .:..:|.::.:..|        .||..|          ||||:.            ||...|   
 Worm   128 HNLKIAENLMQKSR--------KLVRQRQSQRNLEPELCLQQKN------------ASDCGL--- 169

  Fly   259 TDHVADYVA 267
              |||.|:|
 Worm   170 --HVAQYLA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 25/103 (24%)
ulp-3NP_001023477.1 ULP1 <12..171 CDD:227489 43/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I3660
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.