DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and nep2

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_595608.1 Gene:nep2 / 2540263 PomBaseID:SPBC32H8.02c Length:415 Species:Schizosaccharomyces pombe


Alignment Length:186 Identity:41/186 - (22%)
Similarity:77/186 - (41%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KPNAKGKVKEKGTDKEKGKFKAKGNGKGKNKNKIRDSKTSTSLALERGSGDGPHQLAEVSLVALR 91
            :|.:.|.....|:|....|.|.||..:....:....||:..|               ..:.:.|.
pombe    23 RPPSTGSSNSNGSDTASPKKKKKGFFRSLFGSSSSGSKSCGS---------------PFTRIWLE 72

  Fly    92 FMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQH---RRYRSE-LDLHFLNPGLAARLRHM-NM 151
            :.::|||.:||...:.....::..:..||...|:.   :|.:.| ..::.|.|.:...|... |.
pombe    73 YFEVSLRKNDVDHFRPGYWILDTNIDFFYEIMLRQVLLKRPKEESQQIYLLRPAMVFFLAQAPNP 137

  Fly   152 RQLWAMVRDRRLNEKQFILVPLS-THP---RPHGHWSLLVISRPDSKFYHYDSLDN 203
            .::.:.: ...:.:..||.:|:: |:.   ....||||||:|......::|||:.|
pombe   138 LEIESAL-PPAMFDASFIFLPINDTNECGIESGSHWSLLVVSVEKGLGWYYDSMSN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 24/96 (25%)
nep2NP_595608.1 Peptidase_C48 90..272 CDD:304959 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.