DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and nep1

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_596375.2 Gene:nep1 / 2539808 PomBaseID:SPBC17D11.01 Length:420 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:61/240 - (25%)
Similarity:97/240 - (40%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SLVALRFMDISLRHSDVQLLQSAN-------EGVNERLVAFYYAYLQHRRYRSEL-DLHFLNPGL 142
            |...|...|:..:..||..|:..|       :.|:|.:     .:|....|.::. ::..|.|.|
pombe     4 SPTVLELFDVCFKQEDVDSLKKPNWFTDVSIDYVDELI-----EHLWFPSYPNQANEILLLRPSL 63

  Fly   143 AARLRH--MNMRQLWAMVRDRRLNEKQFILVP---LSTHPRPHG--HWSLLVISRPDSKFYHYDS 200
            ...|..  ::..:|...:..:.:|.| ::.:|   |..|....|  ||||:|.|.||.:.|:|||
pombe    64 VFLLAEAAISPEELKVALPKKLMNCK-YLFMPINDLDKHAAGSGGSHWSLMVASIPDGQCYYYDS 127

  Fly   201 LDN-----CHSPLAASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTD 260
            |.|     |.|.| |.||:..:.     ||.:   .|:..::|..|.:       .|.|:...|.
pombe   128 LSNGKTKDCRSAL-ARVSDLFKK-----KFTI---ECMPVQQQRNGYD-------CGAHVCAFTL 176

  Fly   261 HVADYVARCGYATSS---LLIAVDQIAAMRTHLV----ELIQSLG 298
            .:...:......|||   |......:.|:|..|.    .:|.|||
pombe   177 ELVRRLLHSPMPTSSMWNLSTFQPDVTAIREQLSRCLDHIINSLG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 27/100 (27%)
nep1NP_596375.2 Peptidase_C48 27..217 CDD:304959 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.