DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and SENP8

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001159812.1 Gene:SENP8 / 123228 HGNCID:22992 Length:212 Species:Homo sapiens


Alignment Length:219 Identity:57/219 - (26%)
Similarity:100/219 - (45%) Gaps:22/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VALRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQHRRYRSELD-LHFLNPGLAARLR-HMN 150
            |.|.:||..||.|||.||...: .:|:.::.|.:.|..:.::....| :.|::|.:...:: ..|
Human     4 VVLSYMDSLLRQSDVSLLDPPS-WLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSN 67

  Fly   151 MRQLWAMVRDRRLNEKQFILVPLSTHPRPHG---HWSLLVISRPDSKFYHYDSLDNCHSPLAASV 212
            ..::...:....|..|:.:.:.::.:.....   ||||||..:..:.|:||||....:|..|..|
Human    68 PAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQV 132

  Fly   213 SETLRAPL--EAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTDHVADYVARCGYATSS 275
            :|.|.|.|  :..|.|.|       |.:|..::.|   ...|::::|.|:.:.....|  ..|.|
Human   133 AEKLEAFLGRKGDKLAFV-------EEKAPAQQNS---YDCGMYVICNTEALCQNFFR--QQTES 185

  Fly   276 L--LIAVDQIAAMRTHLVELIQSL 297
            |  |:....|...|....:||.:|
Human   186 LLQLLTPAYITKKRGEWKDLITTL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 19/92 (21%)
SENP8NP_001159812.1 Protease 11..174 43/173 (25%)
Peptidase_C48 26..174 CDD:420019 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.