DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and senp8

DIOPT Version :9

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001120583.1 Gene:senp8 / 100145737 XenbaseID:XB-GENE-959844 Length:215 Species:Xenopus tropicalis


Alignment Length:186 Identity:44/186 - (23%)
Similarity:85/186 - (45%) Gaps:27/186 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VALRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQHRRYRSEL------DLHFLNPGLAARL 146
            |.:.|.|..||.|||.||...: .:|:.::.|.:.:|.     |.|      .:.||:|.::..:
 Frog     4 VVVSFGDALLRSSDVALLDPPH-WLNDNIIGFTFEFLS-----SSLPPLQAQQVSFLSPEVSQFI 62

  Fly   147 RHMNMRQLWAMVRDRRLNEKQFILVPLSTHPRPHG---HWSLLVISRPDSKFYHYDSLDNCHSPL 208
            :... .:....:....|..|:.:|:|::.:..|..   |||||...|..:.|.||||....::|.
 Frog    63 KCCG-NEASDFLEPLDLPSKELVLIPVNDNTGPEAGGTHWSLLAYVRRYTVFLHYDSSPGTNAPH 126

  Fly   209 AASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTDHVAD 264
            |..:::.|.        .|:.|:...:|..|..:..|   ...|::::|:.:.:::
 Frog   127 ARLMAKNLD--------VLLGGKQNYREEDAPVQHNS---YDCGMYVVCVAEALSE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 23/96 (24%)
senp8NP_001120583.1 ULP1 <17..171 CDD:227489 38/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4722
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46468
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.