DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15446 and SCRT2

DIOPT Version :9

Sequence 1:	NP_608430.2	Gene:	CG15446 / 33088	FlyBaseID:	FBgn0031155	Length:	373	Species:	Drosophila melanogaster
Sequence 2:	NP_149120.1	Gene:	SCRT2 / 85508	HGNCID:	15952	Length:	307	Species:	Homo sapiens

Alignment Length:	67	Identity:	17/67 - (25%)
Similarity:	27/67 - (40%)	Gaps:	5/67 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   285 MGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPH-NCSKCGQVFRTSGFMRMHSVNAC 348
            |..|.....|.|.  :|.:.|..|..:..|.:.  |..:.| .|.:|.:.|....::..|...||
Human   231 MRSHTGEKPFGCA--HCGKAFADRSNLRAHMQT--HSAFKHYRCRQCDKSFALKSYLHKHCEAAC 291

  Fly   349 AR 350
            |:
Human   292 AK 293

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15446	NP_608430.2	None
SCRT2	NP_149120.1	SNAG domain. /evidence=ECO:0000250	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..90
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..148
		C2H2 Zn finger	157..177	CDD:275368
		COG5048	<210..>277	CDD:227381	12/49 (24%)
		C2H2 Zn finger	214..234	CDD:275368	1/2 (50%)
		zf-H2C2_2	227..250	CDD:290200	5/20 (25%)
		C2H2 Zn finger	242..262	CDD:275368	5/23 (22%)
		zf-H2C2_2	254..278	CDD:290200	5/25 (20%)
		C2H2 Zn finger	270..286	CDD:275368	3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900