powered by:
Protein Alignment CG15446 and SCRT2
DIOPT Version :9
Sequence 1: | NP_608430.2 |
Gene: | CG15446 / 33088 |
FlyBaseID: | FBgn0031155 |
Length: | 373 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_149120.1 |
Gene: | SCRT2 / 85508 |
HGNCID: | 15952 |
Length: | 307 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
Similarity: | 27/67 - (40%) |
Gaps: | 5/67 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 285 MGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPH-NCSKCGQVFRTSGFMRMHSVNAC 348
|..|.....|.|. :|.:.|..|..:..|.:. |..:.| .|.:|.:.|....::..|...||
Human 231 MRSHTGEKPFGCA--HCGKAFADRSNLRAHMQT--HSAFKHYRCRQCDKSFALKSYLHKHCEAAC 291
Fly 349 AR 350
|:
Human 292 AK 293
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2462 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.