DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and SCRT1

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_112599.2 Gene:SCRT1 / 83482 HGNCID:15950 Length:348 Species:Homo sapiens


Alignment Length:65 Identity:16/65 - (24%)
Similarity:26/65 - (40%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 MGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPH-NCSKCGQVFRTSGFMRMHSVNAC 348
            |..|.....|.|.  :|.:.|..|..:..|.:.  |..:.| .|.:|.:.|....::..|..:||
Human   267 MRSHTGEKPFGCA--HCGKAFADRSNLRAHMQT--HSAFKHFQCKRCKKSFALKSYLNKHYESAC 327

  Fly   349  348
            Human   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
SCRT1NP_112599.2 SNAG domain. /evidence=ECO:0000250 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..189
C2H2 Zn finger 224..244 CDD:275368
COG5048 <245..>313 CDD:227381 12/49 (24%)
C2H2 Zn finger 250..270 CDD:275368 1/2 (50%)
C2H2 Zn finger 278..298 CDD:275368 5/23 (22%)
C2H2 Zn finger 306..322 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.