DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and snai1b

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_571064.2 Gene:snai1b / 792194 ZFINID:ZDB-GENE-980526-514 Length:256 Species:Danio rerio


Alignment Length:88 Identity:25/88 - (28%)
Similarity:37/88 - (42%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 NSISSLSQIQPLNSTPSANPPIFGANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGH 320
            :|.::||:.|..:.:|...  |.||...:......|....||.:|     :|..|:..|.|.   
Zfish   114 SSPAALSRHQLAHCSPQDG--ISGATSSLTSSRAAFHCKHCPKEY-----NSLGALKMHIRS--- 168

  Fly   321 HNWPHNCSKCGQVFRTSGFMRMH 343
            |..|..||.||:.|.....:|.|
Zfish   169 HTLPCVCSTCGKAFSRPWLLRGH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
snai1bNP_571064.2 C2H2 Zn finger 149..169 CDD:275368 7/27 (26%)
C2H2 Zn finger 175..195 CDD:275368 7/17 (41%)
zf-H2C2_2 188..211 CDD:316026 2/4 (50%)
zf-C2H2 201..223 CDD:306579
C2H2 Zn finger 203..223 CDD:275368
C2H2 Zn finger 231..247 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.