DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and SNAI1

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_005976.2 Gene:SNAI1 / 6615 HGNCID:11128 Length:264 Species:Homo sapiens


Alignment Length:218 Identity:42/218 - (19%)
Similarity:73/218 - (33%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VMQPKSKKANKMPDKVADKLATKSEP------KSEESNVPVKIKVEGVEHNAEGSQSDSMVNTNQ 213
            ::.|.:.....:.|.|   ||.:::|      :.:||....::.....|.:.:|||..|..:   
Human    49 ILNPTASLPMLIWDSV---LAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPS--- 107

  Fly   214 GFTTNRNFIPILSSFPNPYRNMDVTWTEQFNALSNQYY------NHIMNSISSLSQIQPLNSTPS 272
                     |..|||.          :...::|..:.|      ..:...::.||:.:.|.:.  
Human   108 ---------PAPSSFS----------STSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQAR-- 151

  Fly   273 ANPPIFGANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPHNCSKCGQVFR-- 335
                               ..|:|  .||.:.:.|..|:..|.|.   |..|..|..||:.|.  
Human   152 -------------------KAFNC--KYCNKEYLSLGALKMHIRS---HTLPCVCGTCGKAFSRP 192

  Fly   336 --TSGFMRMH------SVNACAR 350
              ..|.:|.|      |...|:|
Human   193 WLLQGHVRTHTGEKPFSCPHCSR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
SNAI1NP_005976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
SNAG domain. /evidence=ECO:0000305|PubMed:20389281, ECO:0000305|PubMed:21300290 1..20
Required and sufficient for interaction with KDM1A. /evidence=ECO:0000269|PubMed:20389281, ECO:0000269|PubMed:23721412 2..7
LATS2 binding 10..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..115 9/50 (18%)
Destruction motif 95..100 0/4 (0%)
Required for FBXL14-triggered degradation 120..151 5/30 (17%)
Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. /evidence=ECO:0000269|PubMed:21577210, ECO:0000269|PubMed:22128911 151..264 20/91 (22%)
C2H2 Zn finger 156..176 CDD:275368 7/24 (29%)
C2H2 Zn finger 182..202 CDD:275368 6/19 (32%)
zf-H2C2_2 195..218 CDD:404364 6/21 (29%)
zf-C2H2 208..230 CDD:395048 3/8 (38%)
C2H2 Zn finger 210..230 CDD:275368 2/6 (33%)
C2H2 Zn finger 238..255 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.