| Sequence 1: | NP_608430.2 | Gene: | CG15446 / 33088 | FlyBaseID: | FBgn0031155 | Length: | 373 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070853.1 | Gene: | snai3 / 567724 | ZFINID: | ZDB-GENE-061013-757 | Length: | 283 | Species: | Danio rerio |
| Alignment Length: | 222 | Identity: | 43/222 - (19%) |
|---|---|---|---|
| Similarity: | 72/222 - (32%) | Gaps: | 71/222 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 203 SQSDSMVNTNQGFTTNRNFIPILSSFPNPYRNMDVTWTEQFNALSNQYYNHIMNSISSLSQIQPL 267
Fly 268 NSTPSANPPIFG--------ANPMVMGRHPPFSVFS--------------------CPL------ 298
Fly 299 ---DYCKENFDSRRAMYK-----HQRETGHHNWP----HNCSKCGQVFRTSGFMRMH---SVNAC 348
Fly 349 ARNLHKFKITKPNELQ-----QLGKKP 370 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15446 | NP_608430.2 | None | |||
| snai3 | NP_001070853.1 | C2H2 Zn finger | 176..196 | CDD:275368 | 5/19 (26%) |
| C2H2 Zn finger | 202..222 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 215..238 | CDD:290200 | 5/13 (38%) | ||
| zf-C2H2 | 228..250 | CDD:278523 | 43/222 (19%) | ||
| C2H2 Zn finger | 230..250 | CDD:275368 | |||
| C2H2 Zn finger | 258..274 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||