DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15446 and scrt1b

DIOPT Version :9

Sequence 1:	NP_608430.2	Gene:	CG15446 / 33088	FlyBaseID:	FBgn0031155	Length:	373	Species:	Drosophila melanogaster
Sequence 2:	NP_001014369.1	Gene:	scrt1b / 541533	ZFINID:	ZDB-GENE-050327-72	Length:	279	Species:	Danio rerio

Alignment Length:	65	Identity:	16/65 - (24%)
Similarity:	26/65 - (40%)	Gaps:	5/65 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   285 MGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPH-NCSKCGQVFRTSGFMRMHSVNAC 348
            |..|.....|.|.  :|.:.|..|..:..|.:.  |..:.| .|.:|.:.|....::..|..:||
Zfish   206 MRSHTGEKPFGCA--HCGKAFADRSNLRAHMQT--HSAFKHFKCKRCNKTFVLKSYLNKHYESAC 266

Fly 349 348
Zfish 267 266

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15446	NP_608430.2	None
scrt1b	NP_001014369.1	zf-C2H2	130..152	CDD:278523
		C2H2 Zn finger	132..152	CDD:275368
		C2H2 Zn finger	163..180	CDD:275371
		COG5048	187..>263	CDD:227381	14/60 (23%)
		zf-C2H2	187..209	CDD:278523	1/2 (50%)
		C2H2 Zn finger	189..209	CDD:275368	1/2 (50%)
		C2H2 Zn finger	217..237	CDD:275368	5/23 (22%)
		zf-C2H2	217..237	CDD:278523	5/23 (22%)
		zf-H2C2_2	229..253	CDD:290200	5/25 (20%)
		C2H2 Zn finger	245..261	CDD:275368	3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900